top of page

CircRNA

Gene

chr17|4938338|4938975|-|3|circRNA|SLC25A11|ENST00000225665.11|5,4,3

SLC25A11

CircRNA UID

circSLC25A11(5,4,3)

Open Reading Frame (ORF)

MARAVVVNAAQLASYSQSKQFLLDSGCRLACCVRPPTPLPALASIPCCLSA

Peptide

AVVVNAAQLASYSQSKQFLLDSGCR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page