top of page

CircRNA

Gene

chr17|48050606|48057502|+|4|circRNA|NFE2L1|NM_003204|2,3,4,5

NFE2L1

CircRNA UID

circNFE2L1(2,3,4,5)

Open Reading Frame (ORF)

MWSGVCPWPWLHRVCFPLGPSGSSSLVFCQGGVRGLTLRRVTCWLERQSSGLDLSFGRF

Peptide

VTCWLERQSSGLDLSFGR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page