top of page

CircRNA

Gene

chr17|47915311|47923274|+|3|circRNA|SP2|ENST00000376741.4|2,3,4

SP2

CircRNA UID

circSP2(2,3,4)

Open Reading Frame (ORF)

MQPSWRQLPRQCRPSTSMVSRSRACLSPSPTQAIHRPAWLPLLL

Peptide

QCRPSTSMVSRSR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page