top of page

CircRNA

Gene

chr17|47577044|47587344|+|7|circRNA|NPEPPS|ENST00000525037.5|4,5,6,7,8,9,10

NPEPPS

Open Reading Frame (ORF)

LHCLLIQKIPVLHPASGLLWLWDMNSPINGLEILLLW

Peptide

IPVLHPASGLLWLWDMNSPINGLEILLLW

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

29

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page