top of page

CircRNA

Gene

chr17|47129392|47172064|—|14|circRNA|CDC27|NM_001114091|16,15,14,13,12,11,10,9,8,7,6,5,4,3

CDC27

Open Reading Frame (ORF)

LSLIPRTLYANFTEPQFYLQMKNISTLRRSLVFTGNLLLPLRKGI

Peptide

SLVFTGNLLLPLR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page