top of page

CircRNA

Gene

chr17|45117993|45118492|—|2|circRNA|PLCD3|ENST00000619929.4|7,6

PLCD3

Open Reading Frame (ORF)

LPRDAAAWSWTAGRGQEGSPSSIMAIPSPPRFSSGTWSKPCATMPSRQAA

Peptide

DAAAWSWTAGRGQEGSPSSIMAIPSPPR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page