top of page

CircRNA

Gene

chr17|44405920|44438715|-|5|circRNA|GPATCH8|ENST00000335500.8|6,5,4,3,2

GPATCH8

CircRNA UID

circGPATCH8(6,5,4,3,2)

Open Reading Frame (ORF)

LLEMSLQDPARMRKNRKKPFGGSMSWQSKENKLNAL

Peptide

KPFGGSMSWQSKENK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page