top of page

CircRNA

Gene

chr17|44147857|44149027|+|1|circRNA|C17orf53|ENST00000319977.8|3

C17orf53

Open Reading Frame (ORF)

LLPAGHPSSPPIPPPEPKLAVSLAQLGSCLTRISCLLWRMQRTGLLAHCL

Peptide

ISCLLWR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page