top of page

CircRNA

Gene

chr17|43377670|43381660|—|3|circRNA|LINC00910|ENST00000341011.11|4,3,2

LINC00910

Open Reading Frame (ORF)

LKTLEAPGVGSLGMVRLAPLEVPRLPWQHCEQWMVLKGSQRRNGTHAPC

Peptide

LKTLEAPGVGSLGMVR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page