top of page

CircRNA

Gene

chr17|43095845|43104956|-|5|circRNA|BRCA1|NM_007298|8,7,6,5,4

BRCA1

Open Reading Frame (ORF)

LLQITPQGTRDEISLDSAKKGAYKKVRDLVNLLKSY

Peptide

VRDLVNLLK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page