top of page

CircRNA

Gene

chr17|43047642|43074521|-|9|circRNA|BRCA1|NM_007298|21,20,19,18,17,16,15,14,13

BRCA1

CircRNA UID

circBRCA1(21,20,19,18,17,16,15,14,13)

Open Reading Frame (ORF)

MIGGTCTVALGVFRIETTHLKRSSLRLLMWRSNSWKSLGHTI

Peptide

IETTHLKR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page