top of page

CircRNA

Gene

chr17|4066446|4086655|—|14|circRNA|ZZEF1|NM_015113|28,27,26,25,24,23,22,21,20,19,18,17,16,15

ZZEF1

Open Reading Frame (ORF)

MKQKSLMSLGNEAEEKHSSEATEVNPESLARGKNASLPKPCFCSYSRAASLCCREMYWLLLRRKRLQSKALKE

Peptide

LQSKALK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page