top of page

CircRNA

Gene

chr17|40289407|40295456|+|7|circRNA|CDC6|ENST00000209728.8|2,3,4,5,6,7,8

CDC6

CircRNA UID

circCDC6(2,3,4,5,6,7,8)

Open Reading Frame (ORF)

MLQFNSVPAKSLLFQEMFAKHWMFAAVLSSCLKPDPRHRLQSVFQKGSCLGH

Peptide

HWMFAAVLSSCLKPDPRHR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

13

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page