top of page

CircRNA

Gene

chr17|4021128|4022828|-|2|circRNA|ZZEF1|NM_015113|45,44

ZZEF1

Open Reading Frame (ORF)

MSEGTERKRWNGQSAALATQSRKSWTPLRAWMSPPEYVSWLTVLRRSVLLSFRPIC

Peptide

AWMSPPEYVSWLTVLRR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page