top of page

CircRNA

Gene

chr17|39723318|39725853|+|7|circRNA|ERBB2|ENST00000584601.5|21,22,23,24,25,26,27

ERBB2

CircRNA UID

circERBB2(21,22,23,24,25,26,27)

Open Reading Frame (ORF)

LGPNLTMGSQPGRSLTCWKRGSGCPSPPSAPLMST

Peptide

LGPNLTMGSQPGR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page