top of page

CircRNA

Gene

chr17|37440504|37465541|+|6|circRNA|TADA2A|ENST00000615182.4|6,7,8,9,10,11

TADA2A

Open Reading Frame (ORF)

MERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRM

Peptide

FIESHACRM

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page