top of page

CircRNA

Gene

chr17|37234974|37284970|-|22|circRNA|ACACA|ENST00000616317.4|25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4

ACACA

CircRNA UID

circACACA(25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4)

Open Reading Frame (ORF)

MNTVLNYIFSHAQVTKKNLLVTMLIVQHVWLAPSKAGPRQKENRFSTRFHCGFSSRICYSLWGK

Peptide

FHCGFSSRICYSLWGK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page