top of page

CircRNA

Gene

chr17|35671753|35674321|+|2|circRNA|AP2B1|NM_001030006|16,17

AP2B1

CircRNA UID

circAP2B1(16,17)

Open Reading Frame (ORF)

LEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNRWDNPSSHHRCLQPLLLHLHLLWSAVD

Peptide

NRWDNPSSHHR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page