top of page

CircRNA

Gene

chr17|35594007|35650789|+|12|circRNA|AP2B1|ENST00000616784.4|2,3,4,5,6,7,8,9,10,11,12,13

AP2B1

CircRNA UID

circAP2B1(2,3,4,5,6,7,8,9,10,11,12,13)

Open Reading Frame (ORF)

LVLWPLCIISLPMLLWKEVMEFIVNTCQFIMGGAH

Peptide

EVMEFIVNTCQFIMGGAH

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page