top of page

CircRNA

Gene

chr17|31527841|31528778|+|3|circRNA|RAB11FIP4|ENST00000621161.4|11,12,13

RAB11FIP4

CircRNA UID

circRAB11FIP4(11,12,13)

Open Reading Frame (ORF)

LRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREVELEHEVKRLKQGAAVGGRKYRA

Peptide

LKQGAAVGGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page