top of page

CircRNA

Gene

chr17|31258343|31265339|+|5|circRNA|NF1|ENST00000356175.7|31,32,33,34,35

NF1

CircRNA UID

circNF1(31,32,33,34,35)

Open Reading Frame (ORF)

LKTLSIFYQAGTSKAGNPIFYYVARRWLASVSLRTASVQ

Peptide

WLASVSLRTASVQ

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page