top of page

CircRNA

Gene

chr17|29671934|29703062|—|6|circRNA|SSH2|ENST00000269033.7|8,7,6,5,4,3

SSH2

Open Reading Frame (ORF)

MRAISTQINPQSMNGMQCKMYSPTGPTLQLSSPTSSARAF

Peptide

MYSPTGPTLQLSSPTSSARAF

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page