top of page

CircRNA

Gene

chr17|29650653|29672129|—|5|circRNA|SSH2|ENST00000269033.7|12,11,10,9,8

SSH2

Open Reading Frame (ORF)

LSIITFGYMMKRQRISWRTGMTLTNSSLKQSLHYRAYTRLVKSPERITTTQAAYFSLG

Peptide

TGMTLTNSSLK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page