top of page

CircRNA

Gene

chr17|29267497|29287716|-|2|circRNA|NUFIP2|ENST00000225388.8|3,2

NUFIP2

Open Reading Frame (ORF)

LVILLMVIWVKEQIMMVVDLRADIQLLKKGKLGAIVPRVVKTLI

Peptide

LGAIVPRVVK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page