top of page

CircRNA

Gene

chr17|28921687|28924302|-|2|circRNA|PHF12|ENST00000332830.8|5,4

PHF12

CircRNA UID

circPHF12(5,4)

Open Reading Frame (ORF)

LPMPGSWKGEPAGLAHPHPAPAQRLPPLSRMMSTKTSLTWMRNQ

Peptide

LPMPGSWK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page