top of page

CircRNA

Gene

chr17|28720030|28720682|+|1|ciRNA|RPL23A|ENST00000422514.6|1

RPL23A

Open Reading Frame (ORF)

LQYTWAAWAQPRGLSSGRGSWGGATRQASSAREGQTFGSGKLHASTGWSSMSPGL

Peptide

GSWGGATRQASSAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page