top of page

CircRNA

Gene

chr17|28591697|28593066|-|2|circRNA|SPAG5|NM_006461|4,3

SPAG5

Open Reading Frame (ORF)

LAFPFNCLGSRFPCQSCGPRGGNCRAWSYGGKRNEVSHTS

Peptide

FPCQSCGPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page