top of page

CircRNA

Gene

chr17|2081809|2085901|—|2|circRNA|SMG6|NM_001282326|3,2

SMG6

Open Reading Frame (ORF)

LQKGHSAEVFSGSPLWTRRASAGIQGWKVCVSGTRPRHHGKGNGKPRGNTTGR

Peptide

ASAGIQGWK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page