top of page

CircRNA

Gene

chr17|18865468|18911251|+|6|circRNA|PRPSAP2|NM_001243936|2,3,4,5,6,7

PRPSAP2

CircRNA UID

circPRPSAP2(2,3,4,5,6,7)

Open Reading Frame (ORF)

LRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPRGILLSENKRRLSIIDFKQQSVKH

Peptide

HSPPMVRSVAAIHPSLEIPR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page