top of page

CircRNA

Gene

chr17|18865468|18867334|+|3|circRNA|PRPSAP2|ENST00000414602.5|2,3,4

PRPSAP2

CircRNA UID

circPRPSAP2(2,3,4)

Open Reading Frame (ORF)

MGKVQVYQEPNRGGILLSENKRRLSIIDFKQQSVKH

Peptide

GILLSENKR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page