top of page

CircRNA

Gene

chr17|17792932|17803849|+|2|circRNA|RAI1|NM_030665|3,4

RAI1

Open Reading Frame (ORF)

LGAATKDASTPTTTRVPAMQITSPSHAVFSRKVWFPWQTTELPADLAGNITPRELQAAESGRAKLRPAAAARQGLL

Peptide

LGAATKDASTPTTTR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page