top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|16117887|16139186|—|7|circRNA|NCOR1|ENST00000268712.7|18,17,16,15,14,13,12

NCOR1

Open Reading Frame (ORF)

MVVTGQQLLKWWERKVKLNVKTSILTIKGDTILTTSYSSINRKIMRNKCGSSL

Peptide

MVVTGQQLLK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page