top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|16098366|16101757|-|2|circRNA|NCOR1|ENST00000268712.7|21,20

NCOR1

Open Reading Frame (ORF)

MFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMLKLSSPARTVLKMLLLEETQNLRLSLSPPRKLHPVHLPP

Peptide

AAVIPPMLK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page