top of page

CircRNA

Gene

chr17|16086281|16101805|-|4|circRNA|NCOR1|NM_001190440|22,21,20,19

NCOR1

CircRNA UID

circNCOR1(22,21,20,19)

Open Reading Frame (ORF)

MGGSISQVQKIVLIQKVLLLLHQLKLSSPARTVLKMLLLEETQNLRLSLSPPRKLHPVHLPP

Peptide

MGGSISQVQK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page