top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|16034764|16101805|-|26|circRNA|NCOR1|NM_001190440|44,43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19

NCOR1

Open Reading Frame (ORF)

LYIQKGITIGRRQGGPGKTGPLQQVQKIVLIQKVLLLLHQLKLSSPARTVLKMLLLEETQNLRLSLSPPRKLHPVHLPP

Peptide

VLLLLHQLKLSSPAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page