top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|89895037|89900794|+|5|circRNA|TCF25|ENST00000263347.11|8,9,10,11,12

TCF25

Open Reading Frame (ORF)

LSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGGSAPDEPLPR

Peptide

ASLLIQQALTMFPGGSAPDEPLPR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page