top of page

CircRNA

Gene

chr16|89744958|89767237|-|10|circRNA|FANCA|ENST00000389301.7|36,35,34,33,32,31,30,29,28,27

FANCA

CircRNA UID

circFANCA(36,35,34,33,32,31,30,29,28,27)

Open Reading Frame (ORF)

LPVEETLPEPAAPGTAEATRRPAVCQRILYSSNFLLSLQVFFPVTRYFVQLLISRPY

Peptide

YFVQLLISRPY

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page