top of page

CircRNA

Gene

chr16|89723259|89737905|+|7|circRNA|ZNF276|NR_110128|4,5,6,7,8,9,10

ZNF276

Open Reading Frame (ORF)

MRHSGAKPLHGSDHIQPPVPARLGGVGAWTCGQLRGPAPPSEDTVLRVLRRHPGRVGLRPGPRLHHGYQLQLQGLLAGQCAGSQVAMGQRDGATAAPAPRVEPWGCPSDLPG

Peptide

GPAPPSEDTVLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page