top of page

CircRNA

Gene

chr16|89102603|89133262|+|5|circRNA|ACSF3|ENST00000317447.8|4,5,6,7,8

ACSF3

Open Reading Frame (ORF)

LLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDRAGPQVGMDQRRRDPPRAPAAPRPWCGQRAALSSLGGSHLCDDA

Peptide

AGPQVGMDQRR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page