top of page

CircRNA

Gene

chr16|8801798|8813106|+|6|circRNA|PMM2|ENST00000566983.5|2,3,4,5,6,7

PMM2

Open Reading Frame (ORF)

LMSFLMDGTRDTVCDMWKMTVIRPFISLETKLCQKLPKKWMTSYKN

Peptide

DTVCDMWKMTVIRPFISLETK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page