top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|87708349|87711443|-|3|circRNA|KLHDC4|ENST00000567298.5|11,10,9

KLHDC4

Open Reading Frame (ORF)

LAFPWPWPRITRHCSSGVSVTRKRRRACRASSSTICTSTTPPGTVGLRDS

Peptide

ASSSTICTSTTPPGTVGLR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page