top of page

CircRNA

Gene

chr16|80620762|80633236|-|2|circRNA|CDYL2|ENST00000570137.6|4,3

CDYL2

CircRNA UID

circCDYL2(4,3)

Open Reading Frame (ORF)

LQRSHRRQQTAAPQRSGERVLQRPGLFLPNWPVVQRPAKGEHSDCRSHQALL

Peptide

QQTAAPQR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page