top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|74626342|74661451|-|11|circRNA|RFWD3|ENST00000361070.8|12,11,10,9,8,7,6,5,4,3,2

RFWD3

Open Reading Frame (ORF)

MPNNSQLLLAWPAAKGDQPSSSLFLLMWSAARGYHPSSSQLLLR

Peptide

MPNNSQLLLAWPAAK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page