top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|74626342|74636577|—|5|circRNA|RFWD3|ENST00000361070.8|12,11,10,9,8

RFWD3

Open Reading Frame (ORF)

MPFSKAQRMMATSWCVLGMKQQILPWTCKNLRHIKVRIYSNPGAPKHGS

Peptide

IYSNPGAPKHGS

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page