top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|74360632|74360891|—|1|circRNA|RP11—252A24.2|ENST00000566802.5|2

RP11-252A24.2

Open Reading Frame (ORF)

LVRDMMFYWLLSIVGRQRASPGWQNWSSARNSASAAEARSMALPTQAQVVVCGGGITGTSVAHHQSKMGWKDIVLLEQGSLSS

Peptide

DMMFYWLLSIVGRQR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page