top of page

CircRNA

Gene

chr16|71920738|71923380|+|4|circRNA|IST1|ENST00000544564.5|7,8,9,10

IST1

CircRNA UID

circIST1(7,8,9,10)

Open Reading Frame (ORF)

MDCQWGLIRPFPIFIHLRYQQLPHRMNLLLISSVPSIARNMASYVGPTRLEL

Peptide

MNLLLISSVPSIAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page