top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|71690709|71702597|-|1|ciRNA|PHLPP2|ENST00000568954.5|3

PHLPP2

Open Reading Frame (ORF)

LPEDPTSLRSGALPSSMQMNLKTWGLRSSSSQMAAGSVTSPVVALWTSGGPCSCEGFHCAAPS

Peptide

TWGLRSSSSQMAAGSVTSPVVALWTSGGPCSCEGFHCAAPS

ORF Found in Long-Read

false

Peptide Length

41

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

41

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page