top of page

CircRNA

Gene

chr16|69368375|69372355|-|3|circRNA|TERF2|ENST00000254942.7|6,5,4

TERF2

CircRNA UID

circTERF2(6,5,4)

Open Reading Frame (ORF)

LSPLPQVQGRKINSQHQGLWKSHPENPQGCHYLYQKQRI

Peptide

LSPLPQVQGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page