top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|69155870|69167185|+|6|circRNA|CIRH1A|ENST00000314423.11|11,12,13,14,15,16

CIRH1A

Open Reading Frame (ORF)

MTKPYSTIHFLPRMNQMSSGGAQLMLLKFLRYIRVLRTLSVAVSPHVEVG

Peptide

MNQMSSGGAQLMLLK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page