top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|69150536|69157240|+|6|circRNA|CIRH1A|ENST00000314423.11|7,8,9,10,11,12

CIRH1A

Open Reading Frame (ORF)

MPAFLRSALQILFSEDSTKLFVASNQGALHIVQLSGGSFKHLHAFQPQSARRQFRGGHSRGNSLPFSAGPCDI

Peptide

HLHAFQPQSAR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page